RP11-298P3.3 (N-Term) Antikörper

Produktnummer ABIN632609

Der Kaninchen Polyklonal Anti--Antikörper wurde für WB validiert. Er ist geeignet, in Proben von Human zu detektieren.

Kurzübersicht für RP11-298P3.3 (N-Term) Antikörper (ABIN632609)

Target: RP11-298P3.3

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: RP11-298 P3.3 antibody was raised against the N terminal of RP11-298 3.3

Aufreinigung: Affinity purified

Immunogen: RP11-298 P3.3 antibody was raised using the N terminal of RP11-298 3.3 corresponding to a region with amino acids EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RP.3 Blocking Peptide, (ABIN938214), is also available for use as a blocking control in assays to test for specificity of this RP.3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-290 3.3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: RP11-298P3.3

Hintergrund: The function of RP11-298P3.3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 87 kDa (MW of target protein)